gravatar for Ric

2 hours ago by

Australia

Hi, I have a FASTA file which contains a . after each sequence. How is it possilble to remove the dot?

>gene39576 gene=rps16
MVKLRLKRCGRKQRAVYRIVAIDVRSRREGKDLRKVGFYDPIKNQTYLNVPAILYFLEKG
AQPTGTVQDILKKAEVFKELRPNQS.
>gene39578 gene=psbK
MLNTFSLIGICLNSTLFSSSFFFGKLPEAYAFLNPIVDIMPVIPLFFFLLAFVWQAAVSF
R.
>gene39579 gene=psbI
MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE.
>gene39580 gene=NitoCp007
MIPDVILDVKNKIKRGFPCLIFKFSYDLVYSTHLTKNKNKGFRNLKKKNQVINGKRGIRT
LGTINSYNGLAIRRFSPLSHLSQLKKIITT.
>gene39584 gene=atpA
MVTIRADEISNIIRERIEQYNREVKVVNTGTVLQVGDGIARIHGLDEVMAGELVEFEEGT
IGIALNLESNNVGVVLMGDGLLIQEGSSVKATGRIAQIPVSEAYLGRVINALAKPIDGRG
EISASEFRLIESAAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELIIGDRQTGKTAVA
TDTILNQQGQNVICVYVAIGQKASSVAQVVTTLQERGAMEYTIVVAETADSPATLQYLAP
YTGAALAEYFMYRERHTLIIYDDPSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLE
RAAKLSSSLGEGSMTALPIVETQSGDVSAYIPTNVISITDGQIFLSADLFNSGIRPAINV
GISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFAQFASDLDKATQNQLARGQRLREL
LKQSQSAPLTVEEQIMTIYTGTNGYLDSLEVGQVRKFLVELRTYLKTNKPQFQEIISSTK
TFTEEAEALLKEAIQEQTDRFILQEQA.

Thank you in advance,



Source link