gravatar for saikishoremudhiraj2311

2 hours ago by

d. You are given this FASTA Sequence:

>Q8TAX7_Protein
MKTLPLFVCICALSACFSFSEGRERDHELRHRRHHHQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQNATTISSRENVNTSSSVATLAPVNSPAPQDTTAAPPTPSATTPAPPSSSAPPETTAAPPTPSATTQAPPSSSAPPETTAAPPTPPATTPAPPSSSAPPETTAAPPTPSATTPAPLSSSAPPETTAVPPTPSATTLDPSSASAPPETTAAPPTPSATTPAPPSSPAPQETTAAPITTPNSSPTTLAPDTSETSAAPTHQTTTSVTTQTTTTKQPTSAPGQNKISRFLLYMKNLLNRIIDDMVEQ

Given your expertise working with PDB, Blast, and Swissmodel, generate a 3D structure for this protein. Do you think Homology Modelling or Protein Threading would be the better technique towards deriving the 3D structure for this sequence? Explain which method you would choose. Justify your answer based on the findings you have observed from either running PDB, Blast, or Swissmodel, or any combination of these tools. Limit your response to 5 sentences maximum.



Source link